Faisal / Faisal Odeh is on Nostr

Nuclear engineer ☢️. Bitcoin. Student of Christ.

Last Notes

2023-06-07 15:40:40 UTC

- reply

Now in california, utilities are introducing the idea of electric billing based on income not on consumption.
So if youre poor or a failed/broke business, you get cheap electricity regardless of kwh consumption.

2023-05-27 05:27:35 UTC

The 🇺🇸 citizen is eroding against the pull of tribalism (non-meritocratic) on one end and the globalist (power control) on another. #Bitcoin redeems the power of a citizen that revere a meritocratic system.

2023-05-26 02:51:40 UTC

Being a citizen is a rare phenomena in human history. Yet it is the prerequisite for a non-coercive government. 🇺🇸 citizenry is disappearing by the rise of unaccountable unelected gov officials seizing power by a ruling class. #Bitcoin is power for the 🇺🇸 citizen devoid of rulers

2023-05-25 18:03:59 UTC

Nation's are higher order beings, a macro-organism, comprised of citizens. A citizen need not thank anyone for his rights. It is part and parcel of his citizenship by virtue of his responsibility over private property. In todays digital age, #Bitcoin is the ONLY private property manifestation. Consequently, the disappearing American citizen has a chance to re-emerge as the Light in the world. The realizers and custodians of a consciousness paradigm standing for the Truth of equality under the law (i.e., rules without rulers).

2023-05-23 20:23:00 UTC

The deep state never meant an illusive, conspiratorial, secretive cabal. Its a state within a state that has channeled the separation of powers of a constitutional trilateral structure to an asymmetric power hungry group comprised of unelected officials, regulators, and bureaucrats, to seize the American citizen control over their private property and self-government.
Bitcoin is the substrate for the Checks and Balances system envisioned by a self-governing America. Power back to the citizen.

2023-04-05 12:44:54 UTC

Bitcoin is a clear-headed compass to Truth for the modern-day Being that cant help but be surrounded by endless earthly distractions.

2023-03-03 22:34:11 UTC

- reply

Freedom vs discretion of speech

2023-03-01 15:58:47 UTC

Truth depends on context, not content. The mind in of itself is incapable of holding or comprehending the infinite context of reality. Mankind is destined to greater awareness of greater context as a consequence of the evolution of consciousness.

2023-02-23 15:57:12 UTC

- reply

Talk a walk alone in nature.
No screen lights ~1hr before sleep.
Reduce room temperature before sleep.

2023-02-23 15:51:49 UTC

- reply

To become in a flow state is to release abundance of economic energy… unprecedented prosperity

2023-02-23 15:49:36 UTC

The only power that anything has over us is the power of belief we project onto it.

2023-02-19 15:19:23 UTC

A paradigm is a whole worldview, limited by what we view as possible. Therefore, within the old/existing paradigm we are unable to view and comprehend the existence/emergence of a new dimension of reality… unless the old paradigm is challenged. That is when we look within to question our belief systems, models, and filters. It then follows by experiencing periods of confusion, uncertainty, and upset. Dormant within is a reservoir of courage and willingness to endure temporary discomfort, by virtue of the intention we have set to reconnect with our true Self.

2022-12-18 16:46:02 UTC

Hello earthlings

2022-12-17 17:15:40 UTC

lnbc1u1p3em7fvpp5kxt3lqejppenzqet65ezxe53ycurvd52u8g735j7kuy09ax52xsqdqgdehhxarjcqzpgxqrrssrzjqvgptfurj3528snx6e3dtwepafxw5fpzdymw9pj20jj09sunnqmwpapyqqqqqqqnycqqqqlgqqqqqqgq9qsp5g69923w4r4wd95npnf2wzw0af26y93dhqnpucq5z63aperx5h2ks9qyyssqt8u80fwzs0qua60twzppntk695qzf9l7zjdkxcd9dew5nfqc3uynuc59cket63jl5d57djskjf0c0u8d27dfvrgeahprfulpk7sqhggphgg2yk